(data stored in ACNUC30630 zone)

EMBL: CP002000.PE400

CP002000.PE400       Location/Qualifiers
FT   CDS             complement(413371..413763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0404"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42226"
FT                   /db_xref="InterPro:IPR032693"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CY39"
FT                   /protein_id="ADJ42226.1"
FT                   /translation="MKRPTLLIAVVALVVAAGAAWLLWGGNGAKSTTQQAVSGPYTVQF
FT                   SAEQPRIGGNTFAVAVTGPAPEAVTVAPVMAQMGHALTPVPAGPDGPGRFRAADVGLPM
FT                   AGQWEITVSLRGPGGPAQVVFPVLVK"
     MKRPTLLIAV VALVVAAGAA WLLWGGNGAK STTQQAVSGP YTVQFSAEQP RIGGNTFAVA        60
     VTGPAPEAVT VAPVMAQMGH ALTPVPAGPD GPGRFRAADV GLPMAGQWEI TVSLRGPGGP       120
     AQVVFPVLVK                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page