(data stored in ACNUC30630 zone)

EMBL: CP002000.PE433

CP002000.PE433       Location/Qualifiers
FT   CDS             443487..444407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0437"
FT                   /product="periplasmic substrate-binding component of
FT                   ABC-type glycine betaine transport system"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42259"
FT                   /db_xref="GOA:A0A0H3CWH4"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWH4"
FT                   /protein_id="ADJ42259.1"
FT                   /translation="MRWFRNASVVAAALAATLGLAACGGSDSGDKPAAQGKGGAPIVVA
FT                   SFNFTDSQILAEIYAQALEAKGYPVTRKLNLGSRELIYPSLKSGELQFIPEYQGAAITT
FT                   GFGKEAGKTAQEEHEQLAKLFEPSGIGLLNFAAAEDKNTYIIKSDLAKEKGIASISDLK
FT                   KLDKVVMAGPPECEKRLPCFKGFTDVYKLTNITFQTIQEAGPRVEQLKSGAVTVIPVDS
FT                   VSPLTGDSKYTVLKDDLNIVPTENVVPAVTKKVLDERGADFANAVNAVSGKLTTDVMRD
FT                   LNKRVDSDGERAADVAKDWLGQAGL"
     MRWFRNASVV AAALAATLGL AACGGSDSGD KPAAQGKGGA PIVVASFNFT DSQILAEIYA        60
     QALEAKGYPV TRKLNLGSRE LIYPSLKSGE LQFIPEYQGA AITTGFGKEA GKTAQEEHEQ       120
     LAKLFEPSGI GLLNFAAAED KNTYIIKSDL AKEKGIASIS DLKKLDKVVM AGPPECEKRL       180
     PCFKGFTDVY KLTNITFQTI QEAGPRVEQL KSGAVTVIPV DSVSPLTGDS KYTVLKDDLN       240
     IVPTENVVPA VTKKVLDERG ADFANAVNAV SGKLTTDVMR DLNKRVDSDG ERAADVAKDW       300
     LGQAGL                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page