(data stored in ACNUC30630 zone)

EMBL: CP002000.PE434

CP002000.PE434       Location/Qualifiers
FT   CDS             complement(444409..445188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0438"
FT                   /product="putative methyltransferase,
FT                   S-adenosyl-L-methionine (SAM)-MTase protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42260"
FT                   /db_xref="GOA:A0A0H3CW60"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CW60"
FT                   /protein_id="ADJ42260.1"
FT                   /translation="MWQSGDAYEAYIGRWSRRIAATFVRQLGAPASRRWLDVGCGTGAL
FT                   TSAVLAAADPAEVVGADPSEGFLKTARASVTDPRATFTLADARSLPFPDARFDVVVSGL
FT                   VLNFVPDPDRAAAEIARVTAPGGLAATYLWDLAEGMELIRRFWDAAGELDPEAVAELDE
FT                   GRRFTLCRPEPLGRLWTDAGFTAVSVGEIRIPTVFADFDDYWQPFLGAQGPAPTYLATL
FT                   PPAHRDRIRELLRSRLPMDPDGSIPLTARAWVVSGIA"
     MWQSGDAYEA YIGRWSRRIA ATFVRQLGAP ASRRWLDVGC GTGALTSAVL AAADPAEVVG        60
     ADPSEGFLKT ARASVTDPRA TFTLADARSL PFPDARFDVV VSGLVLNFVP DPDRAAAEIA       120
     RVTAPGGLAA TYLWDLAEGM ELIRRFWDAA GELDPEAVAE LDEGRRFTLC RPEPLGRLWT       180
     DAGFTAVSVG EIRIPTVFAD FDDYWQPFLG AQGPAPTYLA TLPPAHRDRI RELLRSRLPM       240
     DPDGSIPLTA RAWVVSGIA                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page