(data stored in ACNUC30630 zone)

EMBL: CP002000.PE444

CP002000.PE444       Location/Qualifiers
FT   CDS             complement(451938..452738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0448"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42270"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CW68"
FT                   /protein_id="ADJ42270.1"
FT                   /translation="MAHRSKLTPVGAPTRGTTNPNRLRRVDRWIASAPATSRLLRSAEA
FT                   PLVVDLGYGASPVTTVELARWLRRVRPDVRVLGLELDPVRVAAAQPAASPPLLEFRRGG
FT                   FELAGTRPVLVRAFNVLRQYAEDEVAGAWDLMLGSMPAEGLLVEGTCDEIGRLSTWVLV
FT                   SRAGPVSLTLSMRLAGLEKPSMIAERLPKALIHRNVPGERVHSLLSELDACWATAAPHQ
FT                   AFGVRSRWLETVRLLAARGRPVLGPPSRIRLGELTVPWAAVAPG"
     MAHRSKLTPV GAPTRGTTNP NRLRRVDRWI ASAPATSRLL RSAEAPLVVD LGYGASPVTT        60
     VELARWLRRV RPDVRVLGLE LDPVRVAAAQ PAASPPLLEF RRGGFELAGT RPVLVRAFNV       120
     LRQYAEDEVA GAWDLMLGSM PAEGLLVEGT CDEIGRLSTW VLVSRAGPVS LTLSMRLAGL       180
     EKPSMIAERL PKALIHRNVP GERVHSLLSE LDACWATAAP HQAFGVRSRW LETVRLLAAR       240
     GRPVLGPPSR IRLGELTVPW AAVAPG                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page