(data stored in ACNUC30630 zone)

EMBL: CP002000.PE460

CP002000.PE460       Location/Qualifiers
FT   CDS             468211..469029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0465"
FT                   /product="aromatic compounds degradation protein paaI"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42286"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYD4"
FT                   /protein_id="ADJ42286.1"
FT                   /translation="MDGTAVSFDTASAARSLGDGTFTAVLRAEWAIGSHPHGGFLIALL
FT                   ARAAIAALHERGEPHAEPLVVSAEFLHAPALGPVLLRTDVRKVGRRATVVEVRLEQRGR
FT                   SCVEARVTTGRLPMRRPEWTDVPSMPAEPPPGALAMAESTEGPFNLAKGCEVRLDPATA
FT                   GYLTGRTDEPPRMRLWVRPRHSLVDPYFSLLASDVNPPVVMNLGRIGWAPTVQLTALLR
FT                   TRPAPGWLRVVVESRSVHESWFDSDATVVDAQGRLVCQARQLGLAPAPGG"
     MDGTAVSFDT ASAARSLGDG TFTAVLRAEW AIGSHPHGGF LIALLARAAI AALHERGEPH        60
     AEPLVVSAEF LHAPALGPVL LRTDVRKVGR RATVVEVRLE QRGRSCVEAR VTTGRLPMRR       120
     PEWTDVPSMP AEPPPGALAM AESTEGPFNL AKGCEVRLDP ATAGYLTGRT DEPPRMRLWV       180
     RPRHSLVDPY FSLLASDVNP PVVMNLGRIG WAPTVQLTAL LRTRPAPGWL RVVVESRSVH       240
     ESWFDSDATV VDAQGRLVCQ ARQLGLAPAP GG                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page