(data stored in ACNUC30630 zone)

EMBL: CP002000.PE467

CP002000.PE467       Location/Qualifiers
FT   CDS             complement(475072..475974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0472"
FT                   /product="CAAX amino terminal protease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42293"
FT                   /db_xref="GOA:A0A0H3CVI9"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="InterPro:IPR042150"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVI9"
FT                   /protein_id="ADJ42293.1"
FT                   /translation="MVATRVEIGEERTDGGWRDGIRRRPLTWFFVLANLLSWLAWTPYI
FT                   LSGNGLGVLPFRFPEVLGTAQFAGVLPGAYLGPIGAAFFVTAVADGRTGLRRWTARLFK
FT                   WRVSWLWYVGVVLSVPALLTIATVALSEQNPVLPAVATLVAYVPGLILQLLTTGLAEEP
FT                   GWRDFALPRLQHRYGPLGGTLILGPLWGVWHLPLFFTEWGGWPDVTWLTPLEFIATCVT
FT                   FSIIMTWVFNRTGQSLPLAMLLHTSVNNFFSLAWSEMFPGLSSRDTTHAFLLASTAVAL
FT                   VLLLATRGRLGYRRPELTA"
     MVATRVEIGE ERTDGGWRDG IRRRPLTWFF VLANLLSWLA WTPYILSGNG LGVLPFRFPE        60
     VLGTAQFAGV LPGAYLGPIG AAFFVTAVAD GRTGLRRWTA RLFKWRVSWL WYVGVVLSVP       120
     ALLTIATVAL SEQNPVLPAV ATLVAYVPGL ILQLLTTGLA EEPGWRDFAL PRLQHRYGPL       180
     GGTLILGPLW GVWHLPLFFT EWGGWPDVTW LTPLEFIATC VTFSIIMTWV FNRTGQSLPL       240
     AMLLHTSVNN FFSLAWSEMF PGLSSRDTTH AFLLASTAVA LVLLLATRGR LGYRRPELTA       300
//

If you have problems or comments...

PBIL Back to PBIL home page