(data stored in ACNUC30630 zone)

EMBL: CP002000.PE473

CP002000.PE473       Location/Qualifiers
FT   CDS             481124..482680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0478"
FT                   /product="molybdopterin binding domain-containing
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42299"
FT                   /db_xref="GOA:A0A0H3CWK6"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWK6"
FT                   /protein_id="ADJ42299.1"
FT                   /translation="MSTLQDAPPEAPRRLSLPVATLIGLLALAAALGVGHLIAGFVGYT
FT                   ASPFIAVANYVIDHSPTAVVKWAERTLGTWDKPVLKLGLGVVLVLFALVAGQLSRRTPR
FT                   AGQVLVAVLGVAGVAAVYVRSDLGQVSLLAPVAALVAGLAVFTFLHRLALPVDVVGERG
FT                   FDRRKFLRAGVGVAAGSGIAAVVGQVAGTSKNAEDSRAAVGPLVPARTAPPLPADADFA
FT                   KLGSPPFLTPNADFYRIDTALVVPQIRTEDWSLKIHGMVDREVSFSYADIRNRPLVERR
FT                   VTLTCVSNEVGGPLISNATWLGVDLVDLLDQAGVQPGAEQMFATSVDGWTCGTPANVAL
FT                   DPDRGAMLAIGMNGEPLPVEHGFPARIVIPGLYGYVSATKWVESLEFTRWDARQAYWLS
FT                   RGWAEQAPIKTESRIDTPHGFAGVTAGKVRLTGTAWAQHTGIAKVEVRLDQGPWQPATL
FT                   AAEVSKDTWRMWWIELDVPKGTHQASVRATDQDGYTQTENRADPVPDGATGWHSVTLDA
FT                   R"
     MSTLQDAPPE APRRLSLPVA TLIGLLALAA ALGVGHLIAG FVGYTASPFI AVANYVIDHS        60
     PTAVVKWAER TLGTWDKPVL KLGLGVVLVL FALVAGQLSR RTPRAGQVLV AVLGVAGVAA       120
     VYVRSDLGQV SLLAPVAALV AGLAVFTFLH RLALPVDVVG ERGFDRRKFL RAGVGVAAGS       180
     GIAAVVGQVA GTSKNAEDSR AAVGPLVPAR TAPPLPADAD FAKLGSPPFL TPNADFYRID       240
     TALVVPQIRT EDWSLKIHGM VDREVSFSYA DIRNRPLVER RVTLTCVSNE VGGPLISNAT       300
     WLGVDLVDLL DQAGVQPGAE QMFATSVDGW TCGTPANVAL DPDRGAMLAI GMNGEPLPVE       360
     HGFPARIVIP GLYGYVSATK WVESLEFTRW DARQAYWLSR GWAEQAPIKT ESRIDTPHGF       420
     AGVTAGKVRL TGTAWAQHTG IAKVEVRLDQ GPWQPATLAA EVSKDTWRMW WIELDVPKGT       480
     HQASVRATDQ DGYTQTENRA DPVPDGATGW HSVTLDAR                               518
//

If you have problems or comments...

PBIL Back to PBIL home page