(data stored in ACNUC30630 zone)

EMBL: CP002000.PE483

CP002000.PE483       Location/Qualifiers
FT   CDS             491736..492074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0488"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42309"
FT                   /db_xref="GOA:A0A0H3CWL4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWL4"
FT                   /protein_id="ADJ42309.1"
FT                   /translation="MIDLPQPTGAELWPPEEPGPRARLHKPWRTLVAAVEVVLAVVAGW
FT                   AAYSCWHSSVATVVTRTDDGAVLESHRYFGGLLAAAIGLGTVAALLLVDAVRQLSLAIR
FT                   ARSAKTKA"
     MIDLPQPTGA ELWPPEEPGP RARLHKPWRT LVAAVEVVLA VVAGWAAYSC WHSSVATVVT        60
     RTDDGAVLES HRYFGGLLAA AIGLGTVAAL LLVDAVRQLS LAIRARSAKT KA               112
//

If you have problems or comments...

PBIL Back to PBIL home page