(data stored in ACNUC30630 zone)

EMBL: CP002000.PE484

CP002000.PE484       Location/Qualifiers
FT   CDS             492137..493453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0489"
FT                   /product="RND family efflux transporter MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42310"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWA3"
FT                   /protein_id="ADJ42310.1"
FT                   /translation="MTRVRASKAWVINGALVVLLAGAGFGIYQAFTPEPSSAQAQSRST
FT                   PVRRATVTETVSAAGTLASSYTGAANFATAGKVTSIDVKVGDVVSAGQKLATVDSTQAA
FT                   KQLQVAKANLAVAQNALNTAETAEATPATGQNSQNSQNAQNSAQAAANNVTSAQAKLDQ
FT                   AQLDVQTAQQTLDNTTLYAPGAGTVTAINGAVGQQSSSGSSATSQSSSSGSGQGGQGSS
FT                   SNSGAAASSSSSSGSGFITITNLTGLVVNTSVAEIDVSKVKAGQKATVTLNALPDKPVQ
FT                   ATVSSINLTPTTSGSVVSYGAQLALTSPPDGLRPGQSASVVITVAEADNALSVPAAAVQ
FT                   TVGSTNLVTVQENGQNVPRQVQVGLRGEATVQITSGLTEGENVVLTGTASTGATGGTGR
FT                   TGGTGGFPGGGTGGFPGGGQRGTGTGTGTGAGGGFGGRG"
     MTRVRASKAW VINGALVVLL AGAGFGIYQA FTPEPSSAQA QSRSTPVRRA TVTETVSAAG        60
     TLASSYTGAA NFATAGKVTS IDVKVGDVVS AGQKLATVDS TQAAKQLQVA KANLAVAQNA       120
     LNTAETAEAT PATGQNSQNS QNAQNSAQAA ANNVTSAQAK LDQAQLDVQT AQQTLDNTTL       180
     YAPGAGTVTA INGAVGQQSS SGSSATSQSS SSGSGQGGQG SSSNSGAAAS SSSSSGSGFI       240
     TITNLTGLVV NTSVAEIDVS KVKAGQKATV TLNALPDKPV QATVSSINLT PTTSGSVVSY       300
     GAQLALTSPP DGLRPGQSAS VVITVAEADN ALSVPAAAVQ TVGSTNLVTV QENGQNVPRQ       360
     VQVGLRGEAT VQITSGLTEG ENVVLTGTAS TGATGGTGRT GGTGGFPGGG TGGFPGGGQR       420
     GTGTGTGTGA GGGFGGRG                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page