(data stored in ACNUC30630 zone)

EMBL: CP002000.PE49

CP002000.PE49        Location/Qualifiers
FT   CDS             complement(51698..53674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0051"
FT                   /product="serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41875"
FT                   /db_xref="GOA:A0A0H3CV21"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV21"
FT                   /protein_id="ADJ41875.1"
FT                   /translation="MSTPRLLSNRYELGETLGYGGMSEVHHGHDVRLGREVAIKILRAD
FT                   LARDPQFLERFRREAQNAAALNHPAIVAVYDTGEANAEFGPLPYIVMEYVEGRTLRDIV
FT                   KTEGPMSQKRAMEVMADVCAALDFSHRHGIVHRDVKPANVMITKNGAVKVMDFGIARAM
FT                   HDGQSAMTQTAAVIGTAQYLSPEQARGESVDARSDVYAAGCVLYELITGEPPFTGDSPV
FT                   AVAYQHVREDPSAPSSVNPAVAPELDAVVLKALAKGPANRYQSAAEMRSDLVRTLSGQR
FT                   PVAPMVMSEDERTQVMNADRRQPQRYDEYSEPDDEDPKAKRRRRAILAAVAAVFVLGAV
FT                   LLIMWLSNAFKSNDPTTVAVPDVLHQTVPQARETLISKGFTGTVEQKQVTCGVQPTDGN
FT                   PQCGQDDVNRVIKIDPGVGTQVASTQKMTLYVGVAPGKSSVPDLKGKTRDQAEQALTDA
FT                   KLTLDGSVQETEVSDPNQAGLVLAQNPPSGSQVDQGTSVKITIGKSKQLKTVTDFTNQA
FT                   YSKAKSSLESQGFTTKRVDQASETVPKDTVITQNPNGGQLAVGSQIVLTVSTGPDSSSQ
FT                   IQMPLLAGMTLDQAQDKLSSMGWTGKFNQKSDKNSNAPEGTITGQNPSAGTMINRDQNV
FT                   TVNVSEGNGFPSITFPTTTRTSN"
     MSTPRLLSNR YELGETLGYG GMSEVHHGHD VRLGREVAIK ILRADLARDP QFLERFRREA        60
     QNAAALNHPA IVAVYDTGEA NAEFGPLPYI VMEYVEGRTL RDIVKTEGPM SQKRAMEVMA       120
     DVCAALDFSH RHGIVHRDVK PANVMITKNG AVKVMDFGIA RAMHDGQSAM TQTAAVIGTA       180
     QYLSPEQARG ESVDARSDVY AAGCVLYELI TGEPPFTGDS PVAVAYQHVR EDPSAPSSVN       240
     PAVAPELDAV VLKALAKGPA NRYQSAAEMR SDLVRTLSGQ RPVAPMVMSE DERTQVMNAD       300
     RRQPQRYDEY SEPDDEDPKA KRRRRAILAA VAAVFVLGAV LLIMWLSNAF KSNDPTTVAV       360
     PDVLHQTVPQ ARETLISKGF TGTVEQKQVT CGVQPTDGNP QCGQDDVNRV IKIDPGVGTQ       420
     VASTQKMTLY VGVAPGKSSV PDLKGKTRDQ AEQALTDAKL TLDGSVQETE VSDPNQAGLV       480
     LAQNPPSGSQ VDQGTSVKIT IGKSKQLKTV TDFTNQAYSK AKSSLESQGF TTKRVDQASE       540
     TVPKDTVITQ NPNGGQLAVG SQIVLTVSTG PDSSSQIQMP LLAGMTLDQA QDKLSSMGWT       600
     GKFNQKSDKN SNAPEGTITG QNPSAGTMIN RDQNVTVNVS EGNGFPSITF PTTTRTSN         658
//

If you have problems or comments...

PBIL Back to PBIL home page