(data stored in ACNUC30630 zone)

EMBL: CP002000.PE495

CP002000.PE495       Location/Qualifiers
FT   CDS             502815..504152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42321"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYH0"
FT                   /protein_id="ADJ42321.1"
FT                   /translation="MTGPSEESAPGHPEQAEPAAAAPQPGLFADDRTDSHPHPETSGAF
FT                   DVQPTQAVAPPPNPAVSGPHQVPNPAVSGPHQVPYGYDRNLPPLQPQYGDPAQQYQANA
FT                   QYPQQPSGPQQPSGLPQPQGGRHAAPQQPGHGHDLSTAHLVKQTRRPPQSGWRKALYVG
FT                   SGKLVNPGESPADTRRRELIARVNQPLRGCYKIAMLSLKGGVGKTTVTTTLGSTFASLR
FT                   GDRVVAVDANPDRGTLSQKIPLETTATVRHLLRDAARITRYSDVRSYTSQGSSRLEILA
FT                   SEQDPAVSEAFSEDDYRRTVNLLEHFYNIVLTDCGTGLMHSAMKGVLDVADALVVVSSG
FT                   SVDGARSASATLDWLEAHGYGELVKRSVAVINSVRPKGGSVDLDKLSAHFGAKVRAVCK
FT                   VPFDPHLEEGAEIELDRLSGDTRLALLELAATVADGFATPLSQGYR"
     MTGPSEESAP GHPEQAEPAA AAPQPGLFAD DRTDSHPHPE TSGAFDVQPT QAVAPPPNPA        60
     VSGPHQVPNP AVSGPHQVPY GYDRNLPPLQ PQYGDPAQQY QANAQYPQQP SGPQQPSGLP       120
     QPQGGRHAAP QQPGHGHDLS TAHLVKQTRR PPQSGWRKAL YVGSGKLVNP GESPADTRRR       180
     ELIARVNQPL RGCYKIAMLS LKGGVGKTTV TTTLGSTFAS LRGDRVVAVD ANPDRGTLSQ       240
     KIPLETTATV RHLLRDAARI TRYSDVRSYT SQGSSRLEIL ASEQDPAVSE AFSEDDYRRT       300
     VNLLEHFYNI VLTDCGTGLM HSAMKGVLDV ADALVVVSSG SVDGARSASA TLDWLEAHGY       360
     GELVKRSVAV INSVRPKGGS VDLDKLSAHF GAKVRAVCKV PFDPHLEEGA EIELDRLSGD       420
     TRLALLELAA TVADGFATPL SQGYR                                             445
//

If you have problems or comments...

PBIL Back to PBIL home page