(data stored in ACNUC30630 zone)

EMBL: CP002000.PE543

CP002000.PE543       Location/Qualifiers
FT   CDS             554165..555508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0549"
FT                   /product="exopolysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42369"
FT                   /db_xref="GOA:A0A0H3CWR9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWR9"
FT                   /protein_id="ADJ42369.1"
FT                   /translation="MTDDTVRLALVGQVLRRRWRLLAVLAVLGALVGAGASILFSPGYK
FT                   TTSGVLLQGPRQADELLTQAEIATASVVLDRAAAVLPWHPSGIDLKKQVSASVAQSNVV
FT                   TITVSADTAEHAQQLADQVAQQYVKYSTQLASNSADASVQLAQEQRESLRQQVKLTTDK
FT                   ISDLAKNVGGGLTVESVQVRTQLEGLKTSLEQAINDLNQADLATGVGNTVVLGPSQRPT
FT                   SPAAPTMTQFVAGGAVLFFLVGVFGHLFTARTDRRLRGEPEIASALGAPILAGVDVTTP
FT                   PGERSPATGFVGKVRHLLGGDRPWVLPPVATSADEVNRDIRYRRVLARLATGPADVLLL
FT                   VADDDETGRLAAAQLAELADRLSVPLRIFEFSPDRPTVPDATASSGVLVVLGAGTRTAW
FT                   QLVQLAEACTDGGQEIVGAVLTHAVRPGEPEKPGPAAEAPEKALAGSA"
     MTDDTVRLAL VGQVLRRRWR LLAVLAVLGA LVGAGASILF SPGYKTTSGV LLQGPRQADE        60
     LLTQAEIATA SVVLDRAAAV LPWHPSGIDL KKQVSASVAQ SNVVTITVSA DTAEHAQQLA       120
     DQVAQQYVKY STQLASNSAD ASVQLAQEQR ESLRQQVKLT TDKISDLAKN VGGGLTVESV       180
     QVRTQLEGLK TSLEQAINDL NQADLATGVG NTVVLGPSQR PTSPAAPTMT QFVAGGAVLF       240
     FLVGVFGHLF TARTDRRLRG EPEIASALGA PILAGVDVTT PPGERSPATG FVGKVRHLLG       300
     GDRPWVLPPV ATSADEVNRD IRYRRVLARL ATGPADVLLL VADDDETGRL AAAQLAELAD       360
     RLSVPLRIFE FSPDRPTVPD ATASSGVLVV LGAGTRTAWQ LVQLAEACTD GGQEIVGAVL       420
     THAVRPGEPE KPGPAAEAPE KALAGSA                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page