(data stored in ACNUC30630 zone)

EMBL: CP002000.PE556

CP002000.PE556       Location/Qualifiers
FT   CDS             complement(573047..574231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0562"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42382"
FT                   /db_xref="InterPro:IPR007345"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUS8"
FT                   /protein_id="ADJ42382.1"
FT                   /translation="MKRAPRVGVFGLLGSGNLGNDGSLEAVLGYLRAEYPDAVLSALVG
FT                   GPELVRERYGLDATPLHWNQSEYETASGLRSVALKGFGKLVDIARTAAWVRKQDVVIVP
FT                   GMGVLEATLPLRPWGFPYSLFLLSATGRLFGTKVALVCVGANHIGARATRTLVRWSGRL
FT                   AAYRSYRDDISRDAMRAMGVDTSADQVYPDLAFSLPTPAAVAKPGTVGVGVMAYYGGND
FT                   DRAEADRIYRHYVDTMNRFVAWLVDQDRPVRLFIGDRIDRQVVDEIIEKTASPLVTAAP
FT                   AETLDELMHEMAAVDSVVATRYHNVLCALKVAKPTVAIGYAPKNDVLMAEMGLDGFTQR
FT                   AKTVGFDRLVEQFTELENRSAELRRTLQERNEMNAQRLKDQFAALSAALFGGGR"
     MKRAPRVGVF GLLGSGNLGN DGSLEAVLGY LRAEYPDAVL SALVGGPELV RERYGLDATP        60
     LHWNQSEYET ASGLRSVALK GFGKLVDIAR TAAWVRKQDV VIVPGMGVLE ATLPLRPWGF       120
     PYSLFLLSAT GRLFGTKVAL VCVGANHIGA RATRTLVRWS GRLAAYRSYR DDISRDAMRA       180
     MGVDTSADQV YPDLAFSLPT PAAVAKPGTV GVGVMAYYGG NDDRAEADRI YRHYVDTMNR       240
     FVAWLVDQDR PVRLFIGDRI DRQVVDEIIE KTASPLVTAA PAETLDELMH EMAAVDSVVA       300
     TRYHNVLCAL KVAKPTVAIG YAPKNDVLMA EMGLDGFTQR AKTVGFDRLV EQFTELENRS       360
     AELRRTLQER NEMNAQRLKD QFAALSAALF GGGR                                   394
//

If you have problems or comments...

PBIL Back to PBIL home page