(data stored in ACNUC30630 zone)

EMBL: CP002000.PE559

CP002000.PE559       Location/Qualifiers
FT   CDS             complement(576511..577791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0565"
FT                   /product="aminopeptidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42385"
FT                   /db_xref="GOA:A0A0H3CWG3"
FT                   /db_xref="InterPro:IPR012353"
FT                   /db_xref="InterPro:IPR032589"
FT                   /db_xref="InterPro:IPR032610"
FT                   /db_xref="InterPro:IPR032622"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWG3"
FT                   /protein_id="ADJ42385.1"
FT                   /translation="MAGPQLRTGAELHALVERLYPICRSITGDGVRQTLDIIGEHISLE
FT                   RHEVPTGTQVLDWTIPQEWNIRDAYVAAPDGSRVIDFQELNLHVVGYSVPVSRRMPLSE
FT                   LREHLHTLPEQPSWVPYRTSYYAPAWGFCLAQEKLDALPDGDYDVVIDSTLSDGSLTYG
FT                   EHVVPGRVTDEVIVSCHVCHPSLANDNLAGIAVAISLAQQLALAQPHYTYRFLFMPGTI
FT                   GSITWLARNASRIEKVRHGLVLACAGDPGSLTYKKSRRDDAEIDRVMQHVLRSREHRIA
FT                   DFSPYGYDERQFCSPGFNLGVGSLTRTPYAGYPEYHTSADNPDFVSPAAMEDTLGVLKD
FT                   AFGVLDRNRRYVNLSPYGEPQLGKRGLYDSLGGRSDAKQAQMAMLWVLNLSDGEHSLLD
FT                   IAERAGLPFDIVDVAARALHDAGLVKE"
     MAGPQLRTGA ELHALVERLY PICRSITGDG VRQTLDIIGE HISLERHEVP TGTQVLDWTI        60
     PQEWNIRDAY VAAPDGSRVI DFQELNLHVV GYSVPVSRRM PLSELREHLH TLPEQPSWVP       120
     YRTSYYAPAW GFCLAQEKLD ALPDGDYDVV IDSTLSDGSL TYGEHVVPGR VTDEVIVSCH       180
     VCHPSLANDN LAGIAVAISL AQQLALAQPH YTYRFLFMPG TIGSITWLAR NASRIEKVRH       240
     GLVLACAGDP GSLTYKKSRR DDAEIDRVMQ HVLRSREHRI ADFSPYGYDE RQFCSPGFNL       300
     GVGSLTRTPY AGYPEYHTSA DNPDFVSPAA MEDTLGVLKD AFGVLDRNRR YVNLSPYGEP       360
     QLGKRGLYDS LGGRSDAKQA QMAMLWVLNL SDGEHSLLDI AERAGLPFDI VDVAARALHD       420
     AGLVKE                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page