(data stored in ACNUC30630 zone)

EMBL: CP002000.PE561

CP002000.PE561       Location/Qualifiers
FT   CDS             complement(578816..579463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0567"
FT                   /product="LmbE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42387"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUT1"
FT                   /protein_id="ADJ42387.1"
FT                   /translation="MIGLRPDRLDRVVALGAHCDDIAIGAGGTLLTLCTGRPGLRVDAL
FT                   VLSGGGTPREDEERAALAAFCPGADVDVTVLKLPDGRFPANWEEAKNALEDLRRRTDPD
FT                   LVLAPRTDDAHQDHRGLAKLVPTTFRDHLALGYEIVKWDGDLGSPSVYQPLSDELAEEK
FT                   VRLLQEHYASQRQRPWYDREAFLGLARIRGIEAAAKYAEAFFVKKLTLDLKG"
     MIGLRPDRLD RVVALGAHCD DIAIGAGGTL LTLCTGRPGL RVDALVLSGG GTPREDEERA        60
     ALAAFCPGAD VDVTVLKLPD GRFPANWEEA KNALEDLRRR TDPDLVLAPR TDDAHQDHRG       120
     LAKLVPTTFR DHLALGYEIV KWDGDLGSPS VYQPLSDELA EEKVRLLQEH YASQRQRPWY       180
     DREAFLGLAR IRGIEAAAKY AEAFFVKKLT LDLKG                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page