(data stored in ACNUC30630 zone)

EMBL: CP002000.PE578

CP002000.PE578       Location/Qualifiers
FT   CDS             complement(598339..599286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0584"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42404"
FT                   /db_xref="GOA:A0A0H3CWV0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWV0"
FT                   /protein_id="ADJ42404.1"
FT                   /translation="MGLMHSDVIATEHAARLAAVDSLLPGSSPFEAAENAVVLEVATGG
FT                   SAASGLASRVQVDRDAPNAPWRALTEHRLDLQLAGPQPAAVLDALLTRWDEHLRAVAEP
FT                   GDTETAAIVPRASRDAAGAREMLHHGFAPLRVVAVRPAQRLVPATPLGTPGVKIRRAEP
FT                   GDLETAVALGMELHSYDAQYGTVNWRTGVEEILAKDLAEQLKRPEPPLWIAELYGRPLG
FT                   MVSVQHPGETGWISGRVAASRVGYLSSLAVAEAARSSGVGTALATHAHHVLDEEGADVV
FT                   LLHHAAANPLSTPFWYAQGYRPLWTYWQRRPAVR"
     MGLMHSDVIA TEHAARLAAV DSLLPGSSPF EAAENAVVLE VATGGSAASG LASRVQVDRD        60
     APNAPWRALT EHRLDLQLAG PQPAAVLDAL LTRWDEHLRA VAEPGDTETA AIVPRASRDA       120
     AGAREMLHHG FAPLRVVAVR PAQRLVPATP LGTPGVKIRR AEPGDLETAV ALGMELHSYD       180
     AQYGTVNWRT GVEEILAKDL AEQLKRPEPP LWIAELYGRP LGMVSVQHPG ETGWISGRVA       240
     ASRVGYLSSL AVAEAARSSG VGTALATHAH HVLDEEGADV VLLHHAAANP LSTPFWYAQG       300
     YRPLWTYWQR RPAVR                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page