(data stored in ACNUC30630 zone)

EMBL: CP002000.PE602

CP002000.PE602       Location/Qualifiers
FT   CDS             620771..621943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0608"
FT                   /product="ABC transport system substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42428"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVV4"
FT                   /protein_id="ADJ42428.1"
FT                   /translation="MKKLLTVGVLATVSALALSGCAFKGIYDLPLPGGADLGDHPYTVN
FT                   VEFRDVLDLTPQAGVKVDEVPVGRVENVGLTKDGWHALVTLRVNGDVKLPANAIANVKQ
FT                   SSLLGEKYVELASPGADQAHGKLADNATIPLARTNRSVEVEELLGALSLLLNGGGVDQL
FT                   NTITKELNNATSGREPDIKALLDNANQLVTNLDRQSKNITRAIDGLNRLSSTLNDQKDK
FT                   LVGAVDNLGPGLGVLEQQRGQLVTMLQALDNLSGVATDTVNKSQKDLVADLKALTPTLQ
FT                   KLGEAGNDLPKALEILLTFPFSDQAVNGVKGDYFNLFAKVDLNLKTVVENLGNSRQNAL
FT                   SGQLPLAGLTGGVQGTPANQPPPLPIPGTGQQQSKPGLGNLFGLLPGGAG"
     MKKLLTVGVL ATVSALALSG CAFKGIYDLP LPGGADLGDH PYTVNVEFRD VLDLTPQAGV        60
     KVDEVPVGRV ENVGLTKDGW HALVTLRVNG DVKLPANAIA NVKQSSLLGE KYVELASPGA       120
     DQAHGKLADN ATIPLARTNR SVEVEELLGA LSLLLNGGGV DQLNTITKEL NNATSGREPD       180
     IKALLDNANQ LVTNLDRQSK NITRAIDGLN RLSSTLNDQK DKLVGAVDNL GPGLGVLEQQ       240
     RGQLVTMLQA LDNLSGVATD TVNKSQKDLV ADLKALTPTL QKLGEAGNDL PKALEILLTF       300
     PFSDQAVNGV KGDYFNLFAK VDLNLKTVVE NLGNSRQNAL SGQLPLAGLT GGVQGTPANQ       360
     PPPLPIPGTG QQQSKPGLGN LFGLLPGGAG                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page