(data stored in ACNUC30630 zone)

EMBL: CP002000.PE603

CP002000.PE603       Location/Qualifiers
FT   CDS             621943..623208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0609"
FT                   /product="ABC transport system substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42429"
FT                   /db_xref="GOA:A0A0H3CWX3"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWX3"
FT                   /protein_id="ADJ42429.1"
FT                   /translation="MLIRRTKIQLIAFVVISVVAIVYALIRFAGLGSVFGNDGYTVKLQ
FT                   LNESGGIFTNAEVTYRGYNIGRVGEMRLTATGLEADLNIDPSAPKVPADLDAVVANRSA
FT                   VGEQYVDLKPKADQGPYLAAGSVIPATKTTTPVSTDRLIGDLDSLAASVPVDSLRTVVD
FT                   ESYDAFRGTGGDLQKLLDTARSFTTTAQQYLPQTIQLLDAGGQVLDTQNAEAANFASFS
FT                   KSLNELTGTLKNSDGDLRKLIGITPQVASQISQVLAESGPGLGALTANLLTTANLTVTR
FT                   LDGIEQGLVTYPALAGAASSVAPGDGTAHLGLVLNLFNPPACTKGYLPYSKYRTGNDLS
FT                   AKPAKEDAYCAEPKGSPINVRGAQNAPYGGVPVAPSDSDVSANANRPAQELAEERDTRG
FT                   VPGIVGSPGVSLTSLGSLLGLT"
     MLIRRTKIQL IAFVVISVVA IVYALIRFAG LGSVFGNDGY TVKLQLNESG GIFTNAEVTY        60
     RGYNIGRVGE MRLTATGLEA DLNIDPSAPK VPADLDAVVA NRSAVGEQYV DLKPKADQGP       120
     YLAAGSVIPA TKTTTPVSTD RLIGDLDSLA ASVPVDSLRT VVDESYDAFR GTGGDLQKLL       180
     DTARSFTTTA QQYLPQTIQL LDAGGQVLDT QNAEAANFAS FSKSLNELTG TLKNSDGDLR       240
     KLIGITPQVA SQISQVLAES GPGLGALTAN LLTTANLTVT RLDGIEQGLV TYPALAGAAS       300
     SVAPGDGTAH LGLVLNLFNP PACTKGYLPY SKYRTGNDLS AKPAKEDAYC AEPKGSPINV       360
     RGAQNAPYGG VPVAPSDSDV SANANRPAQE LAEERDTRGV PGIVGSPGVS LTSLGSLLGL       420
     T                                                                       421
//

If you have problems or comments...

PBIL Back to PBIL home page