(data stored in ACNUC30630 zone)

EMBL: CP002000.PE604

CP002000.PE604       Location/Qualifiers
FT   CDS             623246..623821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0610"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42430"
FT                   /db_xref="GOA:A0A0H3CWK4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWK4"
FT                   /protein_id="ADJ42430.1"
FT                   /translation="MSTDEPAATSVAEESSAAPPKDASRTLVLGAAALALAALIAAAIF
FT                   GVQWWMAANDDNAGLAASREAVVKAGTNALKAYTEVDYTDLDGFFTRQKAVSDEKMSQQ
FT                   IDQSAPTFRKALADAKTKVTTDVQDVAVEELDDHEGKASFLAAIATTVTQGDKSSAKPL
FT                   RLEVSMSKVGEDWKLSGIDSVPLVAAGQ"
     MSTDEPAATS VAEESSAAPP KDASRTLVLG AAALALAALI AAAIFGVQWW MAANDDNAGL        60
     AASREAVVKA GTNALKAYTE VDYTDLDGFF TRQKAVSDEK MSQQIDQSAP TFRKALADAK       120
     TKVTTDVQDV AVEELDDHEG KASFLAAIAT TVTQGDKSSA KPLRLEVSMS KVGEDWKLSG       180
     IDSVPLVAAG Q                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page