(data stored in ACNUC30630 zone)

EMBL: CP002000.PE606

CP002000.PE606       Location/Qualifiers
FT   CDS             complement(624898..626142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0612"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42432"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUW9"
FT                   /protein_id="ADJ42432.1"
FT                   /translation="MCQECELDVDALPALPPVRLPSPAEAQAAAERSAALADLRRYVAE
FT                   LDGTAKPGLTLLPRWAEACGLVRVLKGTHVPVKKNAKLLTRPVELWARAFETLGDAGYG
FT                   IATEDDEVPFEFGMLFPDFLGGLQMTLYSAGGTPMPLELLYGLADQMPSLVAGLELRED
FT                   SQWRYALRATLAVLDRLGAIERTEADAVELAKIAELTGRPEPDPTLVSLTPLALWALNR
FT                   MLRDEGADAPVVGELATAPLETLCAHVADAPPEIAEAEVAAWVAHRSPADAAAEAVDFL
FT                   REAEGPAQRLFALLTLGAAGDAGVADARTVREEGGIAGAVMAAWLAERSETTAESLTSE
FT                   ELCLSMTDHLAAMDELGVLFDELAALGDPSSIVGVIAAADHPARLRLLDVIAQEHPDRK
FT                   IAKRARKARFTLRQG"
     MCQECELDVD ALPALPPVRL PSPAEAQAAA ERSAALADLR RYVAELDGTA KPGLTLLPRW        60
     AEACGLVRVL KGTHVPVKKN AKLLTRPVEL WARAFETLGD AGYGIATEDD EVPFEFGMLF       120
     PDFLGGLQMT LYSAGGTPMP LELLYGLADQ MPSLVAGLEL REDSQWRYAL RATLAVLDRL       180
     GAIERTEADA VELAKIAELT GRPEPDPTLV SLTPLALWAL NRMLRDEGAD APVVGELATA       240
     PLETLCAHVA DAPPEIAEAE VAAWVAHRSP ADAAAEAVDF LREAEGPAQR LFALLTLGAA       300
     GDAGVADART VREEGGIAGA VMAAWLAERS ETTAESLTSE ELCLSMTDHL AAMDELGVLF       360
     DELAALGDPS SIVGVIAAAD HPARLRLLDV IAQEHPDRKI AKRARKARFT LRQG             414
//

If you have problems or comments...

PBIL Back to PBIL home page