(data stored in ACNUC30630 zone)

EMBL: CP002000.PE61

CP002000.PE61        Location/Qualifiers
FT   CDS             68211..68996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41887"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTC6"
FT                   /protein_id="ADJ41887.1"
FT                   /translation="MSRFAGIVSAGALITFAAAPAALAQTTSETPTTPATTETTSETTT
FT                   TAPPTSATTTPSTSVTTTGTTAPNPTREVTKTTTPGTTTSTSAESEPPKDDYQDNTGHG
FT                   FVGLGGEGVLVIACAAGRPGEVATQYLSVTGGPDQDEADGRLWNYSVRVVDAPAGTTTA
FT                   KFSWTCGGVEGNGTVEFEQEQPPTSTVTATSTPTSTSTSTTSSSAPASSTAPITTASIT
FT                   AVPSTTATSTTPAGNAAPKAQVKVAPKGGVETGFGGTAW"
     MSRFAGIVSA GALITFAAAP AALAQTTSET PTTPATTETT SETTTTAPPT SATTTPSTSV        60
     TTTGTTAPNP TREVTKTTTP GTTTSTSAES EPPKDDYQDN TGHGFVGLGG EGVLVIACAA       120
     GRPGEVATQY LSVTGGPDQD EADGRLWNYS VRVVDAPAGT TTAKFSWTCG GVEGNGTVEF       180
     EQEQPPTSTV TATSTPTSTS TSTTSSSAPA SSTAPITTAS ITAVPSTTAT STTPAGNAAP       240
     KAQVKVAPKG GVETGFGGTA W                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page