(data stored in ACNUC30630 zone)

EMBL: CP002000.PE646

CP002000.PE646       Location/Qualifiers
FT   CDS             711954..712865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0652"
FT                   /product="transketolase C-terminal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42472"
FT                   /db_xref="GOA:A0A0H3CV00"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV00"
FT                   /protein_id="ADJ42472.1"
FT                   /translation="MTAQVTRKQMRTVFAETVIESLATDPRVVMLTADISSWFFWEVKK
FT                   DFPDRVHNFGIREQAMIDIAGGFALAGQRPVVHTYAPFLVERPFEQIKIGLGHQDVGAV
FT                   LVSVGASYDDPSWGRTHQAPGDVALLDTLPGWTVHVPGHEDEVAPLLSKAIAGDNRVYV
FT                   RLSERANSEAVPVSEKFTVLRRGKAGVVLAVGPVLDQVLAATATADVTVLYASTIRPFD
FT                   HAGLREAVAAAAPNVVLVEPYLRGTSAFEVTEALGDVPHRLRSFGTWRDREARVYGTPE
FT                   EHDRLFGVDAESLADSIARFVG"
     MTAQVTRKQM RTVFAETVIE SLATDPRVVM LTADISSWFF WEVKKDFPDR VHNFGIREQA        60
     MIDIAGGFAL AGQRPVVHTY APFLVERPFE QIKIGLGHQD VGAVLVSVGA SYDDPSWGRT       120
     HQAPGDVALL DTLPGWTVHV PGHEDEVAPL LSKAIAGDNR VYVRLSERAN SEAVPVSEKF       180
     TVLRRGKAGV VLAVGPVLDQ VLAATATADV TVLYASTIRP FDHAGLREAV AAAAPNVVLV       240
     EPYLRGTSAF EVTEALGDVP HRLRSFGTWR DREARVYGTP EEHDRLFGVD AESLADSIAR       300
     FVG                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page