(data stored in ACNUC30630 zone)

EMBL: CP002000.RPLJ

CP002000.RPLJ        Location/Qualifiers
FT   CDS             612067..612621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="AMED_0599"
FT                   /product="large subunit ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42419"
FT                   /db_xref="GOA:A0A0H3CWW2"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWW2"
FT                   /protein_id="ADJ42419.1"
FT                   /translation="MAKPDKVAAVAEIAESFRTSSATVVTQYTGLSVSQLSQLRRALGT
FT                   SAKYRVAKNTLVKRAAEDAGIQGLEDLFVGATAIAFVEGEAVDAAKAIRDFAKDNNALV
FT                   IKGGYMDGRALSVDEINRIADLDSREVLLAKAAGAFKAKLSQAAALFQAPASQVARLAA
FT                   ALEEKQRNAAGTEAAEAPAES"
     MAKPDKVAAV AEIAESFRTS SATVVTQYTG LSVSQLSQLR RALGTSAKYR VAKNTLVKRA        60
     AEDAGIQGLE DLFVGATAIA FVEGEAVDAA KAIRDFAKDN NALVIKGGYM DGRALSVDEI       120
     NRIADLDSRE VLLAKAAGAF KAKLSQAAAL FQAPASQVAR LAAALEEKQR NAAGTEAAEA       180
     PAES                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page