(data stored in ACNUC30630 zone)

EMBL: CP002000.SSB

CP002000.SSB         Location/Qualifiers
FT   CDS             complement(375145..375618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="AMED_0360"
FT                   /product="single-strand DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42182"
FT                   /db_xref="GOA:A0A0H3CU68"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CU68"
FT                   /protein_id="ADJ42182.1"
FT                   /translation="MPEITMAGTLTADPEMRFTPSGAGVCSFTLVANDRRLDKESGEWR
FT                   DMGATFLRCTVWRRQAENVADARKGDRLLIVGELKQSEWQDKNTGEKRYGFDVQVREAA
FT                   LSLLWHPAKSARPDRSGGEHTGGTGGGGGGARDPWTAPPATGSAGGFSDEPPF"
     MPEITMAGTL TADPEMRFTP SGAGVCSFTL VANDRRLDKE SGEWRDMGAT FLRCTVWRRQ        60
     AENVADARKG DRLLIVGELK QSEWQDKNTG EKRYGFDVQV REAALSLLWH PAKSARPDRS       120
     GGEHTGGTGG GGGGARDPWT APPATGSAGG FSDEPPF                                157
//

If you have problems or comments...

PBIL Back to PBIL home page