(data stored in ACNUC30630 zone)

EMBL: CP002000.SSUA

CP002000.SSUA        Location/Qualifiers
FT   CDS             270567..271598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssuA"
FT                   /locus_tag="AMED_0259"
FT                   /product="periplasmic substrate-binding component of
FT                   ABC-type sulfonate/nitrate/taurine transport system"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42082"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTW6"
FT                   /protein_id="ADJ42082.1"
FT                   /translation="MVAAVAVAAAGLTACRDSREISLGTTGQPHIKIMVGGLSKVIYLP
FT                   GQLAQQIGAYQKQGLDVELFDQPSGANAETSLLAGEVQAVVGFYDHTIDLQAKEQCIES
FT                   VVQFANVPGEAEMVATKKAGEVKSGADFKGRNLGVTSLGSSTDFLTKALAARGGVSSKE
FT                   YTPVKVGAGQTFISAMNQGSIDAGMTTDPTIAQLTKTGQAKVLYDMRTPEGTKAALGGL
FT                   YPASSLYMGCEIVKRYPDIVQKLANAYVETLKWISAHTPDQVAAMMPPSFAGGDKALYV
FT                   KSLEDSLPMFTKDGRMDPAGAQNVLKVLGASSSNVKPKKDKIDLSKTYTTRFVDAAHAQ
FT                   AQQ"
     MVAAVAVAAA GLTACRDSRE ISLGTTGQPH IKIMVGGLSK VIYLPGQLAQ QIGAYQKQGL        60
     DVELFDQPSG ANAETSLLAG EVQAVVGFYD HTIDLQAKEQ CIESVVQFAN VPGEAEMVAT       120
     KKAGEVKSGA DFKGRNLGVT SLGSSTDFLT KALAARGGVS SKEYTPVKVG AGQTFISAMN       180
     QGSIDAGMTT DPTIAQLTKT GQAKVLYDMR TPEGTKAALG GLYPASSLYM GCEIVKRYPD       240
     IVQKLANAYV ETLKWISAHT PDQVAAMMPP SFAGGDKALY VKSLEDSLPM FTKDGRMDPA       300
     GAQNVLKVLG ASSSNVKPKK DKIDLSKTYT TRFVDAAHAQ AQQ                         343
//

If you have problems or comments...

PBIL Back to PBIL home page