(data stored in ACNUC30630 zone)

EMBL: CP002000.YAER

CP002000.YAER        Location/Qualifiers
FT   CDS             261922..262356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeR"
FT                   /locus_tag="AMED_0248"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42071"
FT                   /db_xref="GOA:A0A0H3CXL5"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CXL5"
FT                   /protein_id="ADJ42071.1"
FT                   /translation="MTAKIEGFHHVKFPVRDLARSREWYERVLGLDVTHEFPDDDGVVR
FT                   GVAGTIDGVPVALRVQEAAAAGLAGFDPVCFSIADRAAADAWIVRLDELGVEHPPLFEA
FT                   TTGWMVRFNDPDGTEIRLYSLAKDDGVDHSGERGYAQPVR"
     MTAKIEGFHH VKFPVRDLAR SREWYERVLG LDVTHEFPDD DGVVRGVAGT IDGVPVALRV        60
     QEAAAAGLAG FDPVCFSIAD RAAADAWIVR LDELGVEHPP LFEATTGWMV RFNDPDGTEI       120
     RLYSLAKDDG VDHSGERGYA QPVR                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page