(data stored in ACNUC30630 zone)

EMBL: CP002010.GATC

CP002010.GATC        Location/Qualifiers
FT   CDS             317736..318086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="BLJ_0247"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99734"
FT                   /db_xref="GOA:D6ZXT8"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXT8"
FT                   /protein_id="ADG99734.1"
FT                   /translation="MRLPDNCVSHTAHIVMAMPTFSREEIVHLGDLARIALTDEEITRL
FT                   QGELNVIADSINKVQEVASDDVPPTANPVPLEAYLRPDVAETPLTQEEALAGGPKTEAG
FT                   MFVAPRILGSEE"
     MRLPDNCVSH TAHIVMAMPT FSREEIVHLG DLARIALTDE EITRLQGELN VIADSINKVQ        60
     EVASDDVPPT ANPVPLEAYL RPDVAETPLT QEEALAGGPK TEAGMFVAPR ILGSEE           116
//

If you have problems or comments...

PBIL Back to PBIL home page