(data stored in ACNUC30630 zone)

EMBL: CP002010.GYRB

CP002010.GYRB        Location/Qualifiers
FT   CDS             5447..7576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="BLJ_0005"
FT                   /product="DNA gyrase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99504"
FT                   /db_xref="GOA:D6ZX58"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX58"
FT                   /protein_id="ADG99504.1"
FT                   /translation="MTEVDPVVTEGSLLADETSKEEQLKAAAERINNAELTEGELDESM
FT                   APEHYEASDLRVLEGLEAVRIRPGMYIGSTGPRGLHHLVYEIVDNSVDEALAGYASHIE
FT                   VTILPDNGIRVVDDGRGIPVDEVPGEGVSGVETVMTKLHAGGKFGGGGYAVSGGLHGVG
FT                   ISVVNALSTRVDIEVRRQGFHWTQTYIDQHPTAPLKQGDPMTEGESTGTSVTFWADPKI
FT                   FETTIYDFETLRSRFQQMAFLNKGLKISLTDERENDQAGDEVAGDAADEPGAKHQTVTY
FT                   QYLNGIKDYVDYLVKVRKATPVEEDVISFEAEDLKLGISAELAMQWTTAYSEAVHTFAN
FT                   TISTTEGGTHEEGFRAALTSLVNRYARDKGILKDKDENLSGDDVREGLTAVISVKLTNP
FT                   QFEGQTKTKLGNSEAKTFVQRVMTDKLGDWFDAHPNEAKNIIQKAIEASRARLAAKKAR
FT                   ENTRRKSIFESAGMPDKLKDCQSSNPEECELFIVEGDSAGGSAIQGRNPITQAILPLRG
FT                   KILNTERASLDRMMKSDTIESLITAVGGGYGEDFDISKVRYHKVIIMADADVDGAHIAT
FT                   LNLTLFFRYMRPMITAGYVYVAMPPLYRLKWTKGPHDFVYTDAERDRVLAEGKANGRQL
FT                   PKGEGIQRYKGLGEMSYQELWETTMDPEHRILKQVHIEDAAAADETFSMLMGDEVEPRR
FT                   LFIQRNAKNVRWIDA"
     MTEVDPVVTE GSLLADETSK EEQLKAAAER INNAELTEGE LDESMAPEHY EASDLRVLEG        60
     LEAVRIRPGM YIGSTGPRGL HHLVYEIVDN SVDEALAGYA SHIEVTILPD NGIRVVDDGR       120
     GIPVDEVPGE GVSGVETVMT KLHAGGKFGG GGYAVSGGLH GVGISVVNAL STRVDIEVRR       180
     QGFHWTQTYI DQHPTAPLKQ GDPMTEGEST GTSVTFWADP KIFETTIYDF ETLRSRFQQM       240
     AFLNKGLKIS LTDERENDQA GDEVAGDAAD EPGAKHQTVT YQYLNGIKDY VDYLVKVRKA       300
     TPVEEDVISF EAEDLKLGIS AELAMQWTTA YSEAVHTFAN TISTTEGGTH EEGFRAALTS       360
     LVNRYARDKG ILKDKDENLS GDDVREGLTA VISVKLTNPQ FEGQTKTKLG NSEAKTFVQR       420
     VMTDKLGDWF DAHPNEAKNI IQKAIEASRA RLAAKKAREN TRRKSIFESA GMPDKLKDCQ       480
     SSNPEECELF IVEGDSAGGS AIQGRNPITQ AILPLRGKIL NTERASLDRM MKSDTIESLI       540
     TAVGGGYGED FDISKVRYHK VIIMADADVD GAHIATLNLT LFFRYMRPMI TAGYVYVAMP       600
     PLYRLKWTKG PHDFVYTDAE RDRVLAEGKA NGRQLPKGEG IQRYKGLGEM SYQELWETTM       660
     DPEHRILKQV HIEDAAAADE TFSMLMGDEV EPRRLFIQRN AKNVRWIDA                   709
//

If you have problems or comments...

PBIL Back to PBIL home page