(data stored in ACNUC30630 zone)

EMBL: CP002010.PE132

CP002010.PE132       Location/Qualifiers
FT   CDS             178627..179229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0138"
FT                   /product="conserved hypothetical membrane protein with
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99631"
FT                   /db_xref="GOA:D6ZXI5"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXI5"
FT                   /protein_id="ADG99631.1"
FT                   /translation="MSTVWVHAAAGCAAIAGWLYKALSRHDSRLPGEEPAVAHDCGSSW
FT                   TILILRMLQVSLRQGSSIPRALDMVGKAVGGDCGARMSEVGNSLTRGVPWADAWHAAMA
FT                   VQHEGAPADSPSKGNTNTTQRDLGLLQSALESSWTHGDMPGVRLESAIEQLDRDERAAI
FT                   ERNAAKLSVKLLMPTGLCFLPAFVLVGVIPAIASFMM"
     MSTVWVHAAA GCAAIAGWLY KALSRHDSRL PGEEPAVAHD CGSSWTILIL RMLQVSLRQG        60
     SSIPRALDMV GKAVGGDCGA RMSEVGNSLT RGVPWADAWH AAMAVQHEGA PADSPSKGNT       120
     NTTQRDLGLL QSALESSWTH GDMPGVRLES AIEQLDRDER AAIERNAAKL SVKLLMPTGL       180
     CFLPAFVLVG VIPAIASFMM                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page