(data stored in ACNUC30630 zone)

EMBL: CP002010.PE176

CP002010.PE176       Location/Qualifiers
FT   CDS             complement(241476..242393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99675"
FT                   /db_xref="InterPro:IPR032564"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXM9"
FT                   /protein_id="ADG99675.1"
FT                   /translation="MDLTPINDFRKSHQVNTKGALAAAIQLNRFFSADTLPIDASDYHT
FT                   NKEGQVKGISKDNCQKILAEYGITRLLAAEGGRTSRGTMALMHDYAELINELRPTAEQF
FT                   NEIEQYWVKRIQAFFTSKPFKLESDNSLSVDAAVEHLLQQAAQRQKENPGTMYVGTVLQ
FT                   HLVAAKLTIVAPEVEINGASVADDPTGRGGDFNVGDTAIHCTTAPASLLMDKCQRNIKA
FT                   GLHPIIITVRDRVKTAWDLASDMGFENRLEVWDLQSFLSSNVHEHGHFTNAARHETLSH
FT                   LVKAYNQIIDEHESDPSLHIEYNG"
     MDLTPINDFR KSHQVNTKGA LAAAIQLNRF FSADTLPIDA SDYHTNKEGQ VKGISKDNCQ        60
     KILAEYGITR LLAAEGGRTS RGTMALMHDY AELINELRPT AEQFNEIEQY WVKRIQAFFT       120
     SKPFKLESDN SLSVDAAVEH LLQQAAQRQK ENPGTMYVGT VLQHLVAAKL TIVAPEVEIN       180
     GASVADDPTG RGGDFNVGDT AIHCTTAPAS LLMDKCQRNI KAGLHPIIIT VRDRVKTAWD       240
     LASDMGFENR LEVWDLQSFL SSNVHEHGHF TNAARHETLS HLVKAYNQII DEHESDPSLH       300
     IEYNG                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page