(data stored in ACNUC30630 zone)

EMBL: CP002010.PE18

CP002010.PE18        Location/Qualifiers
FT   CDS             complement(24179..25492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99517"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX71"
FT                   /protein_id="ADG99517.1"
FT                   /translation="MLRRKIETQLEAWRSAPKRTALLVTGARQIGKTYIIRHFAQQHYD
FT                   HIAELNFIENPDLVALFDRPRDAKNLLMRLELAVNTPLVPGKTLIFFDEVQRCKEMVTA
FT                   IKFLVDDGRFDYALSGSLLGVELEDIRSVPVGYLTELDMYPLDFQEFCWSQHIGNDVFD
FT                   MLAECFAKHQEVDEFIHQRLMELYSKYLVIGGMPAAVDSFVANGSVADVRTIQENIKRE
FT                   YRRDISQYARKEDRLHIRAIYDLVPSELNNPNKRFTFAKIEKNMRFQSVASDFDWLVNA
FT                   DVAVAAYNVDEPCTPLEMSKERNLFKLFYNDVGLLTGSFLKKTALDVLDGNPDINYGSI
FT                   YENAVAQELRAHGFDLYYYNSKKLGELDFLIQDRNDHVLPIEVKSGKSYKRHRAMDNVL
FT                   AHPEYHLNTGYVLGPCNVSVEGNVTYLPVYMAGMFHNE"
     MLRRKIETQL EAWRSAPKRT ALLVTGARQI GKTYIIRHFA QQHYDHIAEL NFIENPDLVA        60
     LFDRPRDAKN LLMRLELAVN TPLVPGKTLI FFDEVQRCKE MVTAIKFLVD DGRFDYALSG       120
     SLLGVELEDI RSVPVGYLTE LDMYPLDFQE FCWSQHIGND VFDMLAECFA KHQEVDEFIH       180
     QRLMELYSKY LVIGGMPAAV DSFVANGSVA DVRTIQENIK REYRRDISQY ARKEDRLHIR       240
     AIYDLVPSEL NNPNKRFTFA KIEKNMRFQS VASDFDWLVN ADVAVAAYNV DEPCTPLEMS       300
     KERNLFKLFY NDVGLLTGSF LKKTALDVLD GNPDINYGSI YENAVAQELR AHGFDLYYYN       360
     SKKLGELDFL IQDRNDHVLP IEVKSGKSYK RHRAMDNVLA HPEYHLNTGY VLGPCNVSVE       420
     GNVTYLPVYM AGMFHNE                                                      437
//

If you have problems or comments...

PBIL Back to PBIL home page