(data stored in ACNUC30630 zone)

EMBL: CP002010.PE195

CP002010.PE195       Location/Qualifiers
FT   CDS             268993..269622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99694"
FT                   /db_xref="GOA:D6ZXP8"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXP8"
FT                   /protein_id="ADG99694.1"
FT                   /translation="MVSPPVSFADSPLVRGGLRSVNMTEKNTLKKSATLAAAGLVVAGA
FT                   LLAGCGESKATPMDDAYAGNSGETEKSQEEQSQSQSNGSDSSDGSDSGSSHNDPSTTTS
FT                   DKKDTGNYKDGNYSINGQYGPVGEDSIDVHLTIKDGNVETVKIIGHPFTTISKNHQDDF
FT                   AKAINGVVDGKPLKGLKVDKVAGASWTSDAFNKALEVARQEASIQE"
     MVSPPVSFAD SPLVRGGLRS VNMTEKNTLK KSATLAAAGL VVAGALLAGC GESKATPMDD        60
     AYAGNSGETE KSQEEQSQSQ SNGSDSSDGS DSGSSHNDPS TTTSDKKDTG NYKDGNYSIN       120
     GQYGPVGEDS IDVHLTIKDG NVETVKIIGH PFTTISKNHQ DDFAKAINGV VDGKPLKGLK       180
     VDKVAGASWT SDAFNKALEV ARQEASIQE                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page