(data stored in ACNUC30630 zone)

EMBL: CP002010.PE202

CP002010.PE202       Location/Qualifiers
FT   CDS             complement(280132..281157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0212"
FT                   /product="conserved hypothetical protein"
FT                   /note="narrowly conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99701"
FT                   /db_xref="InterPro:IPR004555"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXQ5"
FT                   /protein_id="ADG99701.1"
FT                   /translation="MIIDMPNTRTREIAHKIEQLHEERGESATGRVLTLLIATEDADLE
FT                   HALEIANSASREHPCRVIAVVPDTNPADQSGEGEPNETEVAAGVSANRDNPAVDLTDGP
FT                   NDPNDSNLNAQVRFGADAGAGEIIILRPRGGLINHPDTLVIPLLVPDAPVVAWWPTTPP
FT                   SNPAKDLMGAMARSRITDALHSNNPEATIERLRRNWTPEDIDLSWTRLTVWRAMLASML
FT                   DQPPHLPITAVKVTGKADFLPLEMLCAWLRLKLGVPVETEFVPDAQAVTGVYLTREDGV
FT                   ISLERPYEDQALISLPGQTPQEVSVPMRTIEDCLTEELRRIDPDEIYAEVINEGWDLIR
FT                   H"
     MIIDMPNTRT REIAHKIEQL HEERGESATG RVLTLLIATE DADLEHALEI ANSASREHPC        60
     RVIAVVPDTN PADQSGEGEP NETEVAAGVS ANRDNPAVDL TDGPNDPNDS NLNAQVRFGA       120
     DAGAGEIIIL RPRGGLINHP DTLVIPLLVP DAPVVAWWPT TPPSNPAKDL MGAMARSRIT       180
     DALHSNNPEA TIERLRRNWT PEDIDLSWTR LTVWRAMLAS MLDQPPHLPI TAVKVTGKAD       240
     FLPLEMLCAW LRLKLGVPVE TEFVPDAQAV TGVYLTREDG VISLERPYED QALISLPGQT       300
     PQEVSVPMRT IEDCLTEELR RIDPDEIYAE VINEGWDLIR H                           341
//

If you have problems or comments...

PBIL Back to PBIL home page