(data stored in ACNUC30630 zone)

EMBL: CP002010.PE246

CP002010.PE246       Location/Qualifiers
FT   CDS             complement(333366..334892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0258"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99745"
FT                   /db_xref="GOA:D6ZXU9"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXU9"
FT                   /protein_id="ADG99745.1"
FT                   /translation="MQHSKRDNTWSKWGIFLGVAVALGALVVVGWTFMQNRFQPGSSLD
FT                   ADVTIGIDDMPQSLDIRSDSSAAAERLLVDNVYETLVTVDQDNKLQPGLATSWKTSDDG
FT                   LTVTLTLQSGVTFSNGHTLDASDAVWSLQQNVTNKVADVDELGDLASVANPNATTVVIT
FT                   LAKPNPTLLRALSGRLGIVYDSESSSADYQRKAIGSGPFTVADFQPGHSLKLARSDTYH
FT                   GTKAASNVVEFMQYSDADALSKALTDGSLDMAAPVSASTATGLNGKDGLTVKEGATTDK
FT                   VLLAYNNGTDSLLSDEQARKAFRYQIDAAGIASAQPDAAGALGGPISLLEPGYEDLTGL
FT                   YPHDENQAGQMFSYFGAQYLTTVNLVVPEEYRSLAETIKQQIERQPRPTVNLEVLSDED
FT                   YAKRIKDGKWELTVMSMDGTDDAGIFADPDSMFHYDHTEAQQAYADARAATNDADYEAR
FT                   MKAYARLISEDAASDWLYTRKCFTVASTKVSGYPTSMINRRMPLAGLTVK"
     MQHSKRDNTW SKWGIFLGVA VALGALVVVG WTFMQNRFQP GSSLDADVTI GIDDMPQSLD        60
     IRSDSSAAAE RLLVDNVYET LVTVDQDNKL QPGLATSWKT SDDGLTVTLT LQSGVTFSNG       120
     HTLDASDAVW SLQQNVTNKV ADVDELGDLA SVANPNATTV VITLAKPNPT LLRALSGRLG       180
     IVYDSESSSA DYQRKAIGSG PFTVADFQPG HSLKLARSDT YHGTKAASNV VEFMQYSDAD       240
     ALSKALTDGS LDMAAPVSAS TATGLNGKDG LTVKEGATTD KVLLAYNNGT DSLLSDEQAR       300
     KAFRYQIDAA GIASAQPDAA GALGGPISLL EPGYEDLTGL YPHDENQAGQ MFSYFGAQYL       360
     TTVNLVVPEE YRSLAETIKQ QIERQPRPTV NLEVLSDEDY AKRIKDGKWE LTVMSMDGTD       420
     DAGIFADPDS MFHYDHTEAQ QAYADARAAT NDADYEARMK AYARLISEDA ASDWLYTRKC       480
     FTVASTKVSG YPTSMINRRM PLAGLTVK                                          508
//

If you have problems or comments...

PBIL Back to PBIL home page