(data stored in ACNUC30630 zone)

EMBL: CP002010.PE259

CP002010.PE259       Location/Qualifiers
FT   CDS             347345..348181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0272"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99758"
FT                   /db_xref="GOA:D6ZXW2"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXW2"
FT                   /protein_id="ADG99758.1"
FT                   /translation="MRGEASRIADRESRDSLAPKLRDTREDAWRIGNELFTITKVLDDS
FT                   IQLERALTDPSRPVADKVAVLKELLGDNAHPMTMEIMTDLVSRRWSRARDIANAVEDFG
FT                   VDAMMYYADATDATLQVSIELSELHSALLNLPVVRAKLYDYQATSEARVKLFREVFSGK
FT                   TLNKVTMRLAEHATCNLRRRRYLETIQWLINKFSRHMGESMVTVTTATPLKKEQIKRLV
FT                   EVYSAKVGRQVHINSVVDPTVLGGMRIQVGDEVTDNTVVAQLQNLHRKVQTEATPA"
     MRGEASRIAD RESRDSLAPK LRDTREDAWR IGNELFTITK VLDDSIQLER ALTDPSRPVA        60
     DKVAVLKELL GDNAHPMTME IMTDLVSRRW SRARDIANAV EDFGVDAMMY YADATDATLQ       120
     VSIELSELHS ALLNLPVVRA KLYDYQATSE ARVKLFREVF SGKTLNKVTM RLAEHATCNL       180
     RRRRYLETIQ WLINKFSRHM GESMVTVTTA TPLKKEQIKR LVEVYSAKVG RQVHINSVVD       240
     PTVLGGMRIQ VGDEVTDNTV VAQLQNLHRK VQTEATPA                               278
//

If you have problems or comments...

PBIL Back to PBIL home page