(data stored in ACNUC30630 zone)

EMBL: CP002010.PE267

CP002010.PE267       Location/Qualifiers
FT   CDS             355709..356716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99766"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXX0"
FT                   /protein_id="ADG99766.1"
FT                   /translation="MNKRWNELCVAALACVALVVPLTACEGRLPTPAADTSTKVAPDLT
FT                   EAQEKKIRLKILKTIDEADQAKNPDGYAAVMGGPQLDIRISQTTINQRGGGMSKYATIP
FT                   KDIAQTVIPMDDGWPRSVFTITTTTEDQQSKRLLVFDQESAQQNYKLMAMARLFEGAKL
FT                   PKFEIPTIGSQMGTAKDEKLVATPADALTQYADVLQNGSKSQYASKFADDLLRQELANT
FT                   TAKVQEGMQRNNGTQEQKFTVVPEQMWVMRAADGAGDLVVGRINGEWTRKAGDGRESQP
FT                   ASDDEKALFNSDKYTSTMKVTYVNVVALYIPLASSGEQITAVGADRQPVKVEAL"
     MNKRWNELCV AALACVALVV PLTACEGRLP TPAADTSTKV APDLTEAQEK KIRLKILKTI        60
     DEADQAKNPD GYAAVMGGPQ LDIRISQTTI NQRGGGMSKY ATIPKDIAQT VIPMDDGWPR       120
     SVFTITTTTE DQQSKRLLVF DQESAQQNYK LMAMARLFEG AKLPKFEIPT IGSQMGTAKD       180
     EKLVATPADA LTQYADVLQN GSKSQYASKF ADDLLRQELA NTTAKVQEGM QRNNGTQEQK       240
     FTVVPEQMWV MRAADGAGDL VVGRINGEWT RKAGDGRESQ PASDDEKALF NSDKYTSTMK       300
     VTYVNVVALY IPLASSGEQI TAVGADRQPV KVEAL                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page