(data stored in ACNUC30630 zone)

EMBL: CP002010.PE268

CP002010.PE268       Location/Qualifiers
FT   CDS             356963..357937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0281"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99767"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXX1"
FT                   /protein_id="ADG99767.1"
FT                   /translation="MAEQQFNPGVSLAGAVDLEALKHQVKAEPGQAGGAPAAGGYVIDT
FT                   TENTFQAMVQTSATFPILLLLWVPTDDRLFPMARALGDAVNALNGQIQLSRIDISSNPS
FT                   IAQALQVQGVPALFALIAGRPMPLLQGLPGDDELKQLTDEVIPKIIEAAAQSGVNGTAP
FT                   YSGDPDSDAAKSAGATGAVAGAEQVPPEHAEAHRLAEEGDYAGAAAEYERVLGSDPSDA
FT                   LAARERAKALLLARSGAADVRDVRAAAAAAPDDVEAQLAVADIDMIGGQIQDAFDRLLD
FT                   FLAAGHKADIEQVRKRLLEYFAIPEPTDPRLTRARRRLATLMY"
     MAEQQFNPGV SLAGAVDLEA LKHQVKAEPG QAGGAPAAGG YVIDTTENTF QAMVQTSATF        60
     PILLLLWVPT DDRLFPMARA LGDAVNALNG QIQLSRIDIS SNPSIAQALQ VQGVPALFAL       120
     IAGRPMPLLQ GLPGDDELKQ LTDEVIPKII EAAAQSGVNG TAPYSGDPDS DAAKSAGATG       180
     AVAGAEQVPP EHAEAHRLAE EGDYAGAAAE YERVLGSDPS DALAARERAK ALLLARSGAA       240
     DVRDVRAAAA AAPDDVEAQL AVADIDMIGG QIQDAFDRLL DFLAAGHKAD IEQVRKRLLE       300
     YFAIPEPTDP RLTRARRRLA TLMY                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page