(data stored in ACNUC30630 zone)

EMBL: CP002010.PE289

CP002010.PE289       Location/Qualifiers
FT   CDS             378570..378710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99788"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXZ2"
FT                   /protein_id="ADG99788.1"
FT                   /translation="MSAKAEIGFTRDLSAEERRLMQGLCDALQQLLNKQYQRHMWDCSI
FT                   A"
     MSAKAEIGFT RDLSAEERRL MQGLCDALQQ LLNKQYQRHM WDCSIA                       46
//

If you have problems or comments...

PBIL Back to PBIL home page