(data stored in ACNUC30630 zone)

EMBL: CP002010.PE293

CP002010.PE293       Location/Qualifiers
FT   CDS             complement(380503..380874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0310"
FT                   /product="Vacuole effluxer Atg22 like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99792"
FT                   /db_xref="GOA:D6ZXZ6"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXZ6"
FT                   /protein_id="ADG99792.1"
FT                   /translation="MHHDLDIGTIPRETNLCLCAHQPGSSRSHSCVADHEPHAPPHSTS
FT                   VLTTCVNRMHRHHDSPMISRVPRSHYCFFPKTASIIGTFLVATTTSLTGNASFGVLSIA
FT                   VLLVAALVFLLLQKDPTRN"
     MHHDLDIGTI PRETNLCLCA HQPGSSRSHS CVADHEPHAP PHSTSVLTTC VNRMHRHHDS        60
     PMISRVPRSH YCFFPKTASI IGTFLVATTT SLTGNASFGV LSIAVLLVAA LVFLLLQKDP       120
     TRN                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page