(data stored in ACNUC30630 zone)

EMBL: CP002010.PE300

CP002010.PE300       Location/Qualifiers
FT   CDS             385938..388571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0317"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99799"
FT                   /db_xref="GOA:D6ZY03"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY03"
FT                   /protein_id="ADG99799.1"
FT                   /translation="MSITMDTTLASLVTNKRRVSALKSLGIVTVGDALTYYPFRVTEPV
FT                   PLRAIREAAPGQQMAFAAVIRDMRVVPMNARRGYRLEATVDDADFARSRRVPGSTARLT
FT                   FFSYRKSYVDWVSMRLRAGTSVVVSGMPSEYMGQLQFTHPEILTVAPGSAGAGAGLEGY
FT                   ARGAASGNGAFAGSTDPYASVQSAYPPAAAASSGAALKYDADTVQEALTRVCRPRPVYH
FT                   ASSRISSEHIHETILGLLWMMGARTSSTPDGQLAGAGSAGIVAPTTDTIAVQNGEENSG
FT                   TTAESGAEALSQSIPDVLPESVRKAKNLMHRAEAFLAIHDPASTTRFKEAIETLRYEEA
FT                   FVSQTSLLKARSHAHKSAAHSCPLVTDSLRDQFIASLPFSLTAGQQQVIHDIAADLAHD
FT                   WPMQRLLQGEVGSGKTVVALAAMLQAVDAGYQAVLVAPTQVLAEQHAETIGRMVEQLKP
FT                   AIPVTLLTGGMKLAARRKALAAASSGEPGIIVATHAAFSKTFQAPHLALVVIDEQHRFG
FT                   VEQRESLNAKTDDGTTPHLLVMTATPIPRTAAMTWFGDLDISWLTELPGGRKPIRTVVV
FT                   NEADAATMGRMFAHIRARVDAGERAYIVCPRIDADDEGNEGGSGVSAAAGSARGRAAAS
FT                   GSSARTAAGGRATRAAADAIGIDDPYETFDENGETVARPPLHAVAEIADRLQKLPQFQG
FT                   IRFATLTGRDKDDVKTQVMADFAGGETPILVSTTVIEVGVDVKQASCIVIFDADRYGLS
FT                   QLHQLRGRVGRGGTNSWAFLISRAEPGSPAEQRLEVIHHSLDGAEIAQADLEFRGAGDV
FT                   LGDAQSGGKSSLKLLRVVKDADMIADARTRAEQLLAADPELADEVQLAGAVLDFTRGNE
FT                   TFLTSS"
     MSITMDTTLA SLVTNKRRVS ALKSLGIVTV GDALTYYPFR VTEPVPLRAI REAAPGQQMA        60
     FAAVIRDMRV VPMNARRGYR LEATVDDADF ARSRRVPGST ARLTFFSYRK SYVDWVSMRL       120
     RAGTSVVVSG MPSEYMGQLQ FTHPEILTVA PGSAGAGAGL EGYARGAASG NGAFAGSTDP       180
     YASVQSAYPP AAAASSGAAL KYDADTVQEA LTRVCRPRPV YHASSRISSE HIHETILGLL       240
     WMMGARTSST PDGQLAGAGS AGIVAPTTDT IAVQNGEENS GTTAESGAEA LSQSIPDVLP       300
     ESVRKAKNLM HRAEAFLAIH DPASTTRFKE AIETLRYEEA FVSQTSLLKA RSHAHKSAAH       360
     SCPLVTDSLR DQFIASLPFS LTAGQQQVIH DIAADLAHDW PMQRLLQGEV GSGKTVVALA       420
     AMLQAVDAGY QAVLVAPTQV LAEQHAETIG RMVEQLKPAI PVTLLTGGMK LAARRKALAA       480
     ASSGEPGIIV ATHAAFSKTF QAPHLALVVI DEQHRFGVEQ RESLNAKTDD GTTPHLLVMT       540
     ATPIPRTAAM TWFGDLDISW LTELPGGRKP IRTVVVNEAD AATMGRMFAH IRARVDAGER       600
     AYIVCPRIDA DDEGNEGGSG VSAAAGSARG RAAASGSSAR TAAGGRATRA AADAIGIDDP       660
     YETFDENGET VARPPLHAVA EIADRLQKLP QFQGIRFATL TGRDKDDVKT QVMADFAGGE       720
     TPILVSTTVI EVGVDVKQAS CIVIFDADRY GLSQLHQLRG RVGRGGTNSW AFLISRAEPG       780
     SPAEQRLEVI HHSLDGAEIA QADLEFRGAG DVLGDAQSGG KSSLKLLRVV KDADMIADAR       840
     TRAEQLLAAD PELADEVQLA GAVLDFTRGN ETFLTSS                                877
//

If you have problems or comments...

PBIL Back to PBIL home page