(data stored in ACNUC30630 zone)

EMBL: CP002010.PE322

CP002010.PE322       Location/Qualifiers
FT   CDS             413164..413751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0339"
FT                   /product="Resolvase, N-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99821"
FT                   /db_xref="GOA:D6ZY25"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR041718"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY25"
FT                   /protein_id="ADG99821.1"
FT                   /translation="MRVREWARREGFNEQTVWQWCRENRMPVPFERMNTGTIIIHDPKY
FT                   ENQPAAPTANGRTVCYARVSSSDQKDDLQRQADRLKAFAINMGVKSPEVVTETGSGMND
FT                   KRRKLNRLLSDPTVGTLVVERRDRLARMNMGLVESALKAQGRRIIVVDDTEPDDDLVRD
FT                   MAEALTSFCARLYGSRAAKRKTDAALRAARDA"
     MRVREWARRE GFNEQTVWQW CRENRMPVPF ERMNTGTIII HDPKYENQPA APTANGRTVC        60
     YARVSSSDQK DDLQRQADRL KAFAINMGVK SPEVVTETGS GMNDKRRKLN RLLSDPTVGT       120
     LVVERRDRLA RMNMGLVESA LKAQGRRIIV VDDTEPDDDL VRDMAEALTS FCARLYGSRA       180
     AKRKTDAALR AARDA                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page