(data stored in ACNUC30630 zone)

EMBL: CP002010.PE329

CP002010.PE329       Location/Qualifiers
FT   CDS             421450..422403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0346"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstC"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99828"
FT                   /db_xref="GOA:D6ZY32"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY32"
FT                   /protein_id="ADG99828.1"
FT                   /translation="MSSQDKTAVQPVGGKTADKVFRGVAYACGILILVVLAAVFLFLFF
FT                   RAWPLIGGDQAANSDTVSSFTGGKASSFWGYVLPLLFGTVLVSLLALLIAFFVSIGIAL
FT                   FISHYAPKKLATALSYVVDLLAAIPSVIYGLWGGLILVPAIYPFWNWVANHLGFIPLFE
FT                   GPAANPSRTVATVAVVLAVMILPIITSMSRDIFMQTPRLHEEAALALGATKWEMIRLAV
FT                   LPFGKSGIVSASMLALGRALGETMAVLMILSPGLNYSIKLLQASQNQTIAANIAAQYPE
FT                   ANDLGVSTLIGTGLILFLITFVVNFIARKLTEKATA"
     MSSQDKTAVQ PVGGKTADKV FRGVAYACGI LILVVLAAVF LFLFFRAWPL IGGDQAANSD        60
     TVSSFTGGKA SSFWGYVLPL LFGTVLVSLL ALLIAFFVSI GIALFISHYA PKKLATALSY       120
     VVDLLAAIPS VIYGLWGGLI LVPAIYPFWN WVANHLGFIP LFEGPAANPS RTVATVAVVL       180
     AVMILPIITS MSRDIFMQTP RLHEEAALAL GATKWEMIRL AVLPFGKSGI VSASMLALGR       240
     ALGETMAVLM ILSPGLNYSI KLLQASQNQT IAANIAAQYP EANDLGVSTL IGTGLILFLI       300
     TFVVNFIARK LTEKATA                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page