(data stored in ACNUC30630 zone)

EMBL: CP002010.PE341

CP002010.PE341       Location/Qualifiers
FT   CDS             complement(435815..436048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0358"
FT                   /product="conserved hypothetical protein"
FT                   /note="narrowly conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99840"
FT                   /db_xref="GOA:D6ZY44"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020627"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY44"
FT                   /protein_id="ADG99840.1"
FT                   /translation="MLAQAVEHLIKNIVDFPDDVSVKSHENARGELLRVRVNPEDIGRV
FT                   IGRGGRTANAIRTVIQALSDHKVRVDIMDVRR"
     MLAQAVEHLI KNIVDFPDDV SVKSHENARG ELLRVRVNPE DIGRVIGRGG RTANAIRTVI        60
     QALSDHKVRV DIMDVRR                                                       77
//

If you have problems or comments...

PBIL Back to PBIL home page