(data stored in ACNUC30630 zone)

EMBL: CP002010.PE370

CP002010.PE370       Location/Qualifiers
FT   CDS             466643..467911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0388"
FT                   /product="Methicillin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99869"
FT                   /db_xref="GOA:D6ZY73"
FT                   /db_xref="InterPro:IPR003447"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY73"
FT                   /protein_id="ADG99869.1"
FT                   /translation="MRDFVLVKLTDEEFDDFSARHPQGNFQQTSAMGRLRAAQGIDVEY
FT                   LALKEGEKIVAAALFETHRSRFSTFAAIHDGPMCDYHDTEALTFFMDALKRHAKAKGAS
FT                   QLEITPESPYRLRDTNGASLPDDQNGAPDNKLIERLEAISFTHGGFTVGYTAVPRWRYL
FT                   KDLTGITDEKSLLKSYDKRTQWSVKRAQSMGVHVRELSDDELGVFARIEQQTAERRSFE
FT                   YRGEAYFHRFKEAFGNKAHFMVAEIHIDEYVADMTAKREALSAKVAALTAKNAEHPTTK
FT                   TERQLGEETRNLAAAEKRLNEAAEFAKDGDVLPAAASLFVEHPREVIYLFSGSVEQYKP
FT                   FYASALIQHDAMLHFCVEHGLSRYNFYGIDGVFDDPDDEGRGVLEFKQGFNGYVEELPG
FT                   EFVLPVKPVAYAMKQFAHKLLSR"
     MRDFVLVKLT DEEFDDFSAR HPQGNFQQTS AMGRLRAAQG IDVEYLALKE GEKIVAAALF        60
     ETHRSRFSTF AAIHDGPMCD YHDTEALTFF MDALKRHAKA KGASQLEITP ESPYRLRDTN       120
     GASLPDDQNG APDNKLIERL EAISFTHGGF TVGYTAVPRW RYLKDLTGIT DEKSLLKSYD       180
     KRTQWSVKRA QSMGVHVREL SDDELGVFAR IEQQTAERRS FEYRGEAYFH RFKEAFGNKA       240
     HFMVAEIHID EYVADMTAKR EALSAKVAAL TAKNAEHPTT KTERQLGEET RNLAAAEKRL       300
     NEAAEFAKDG DVLPAAASLF VEHPREVIYL FSGSVEQYKP FYASALIQHD AMLHFCVEHG       360
     LSRYNFYGID GVFDDPDDEG RGVLEFKQGF NGYVEELPGE FVLPVKPVAY AMKQFAHKLL       420
     SR                                                                      422
//

If you have problems or comments...

PBIL Back to PBIL home page