(data stored in ACNUC30630 zone)

EMBL: CP002010.PE385

CP002010.PE385       Location/Qualifiers
FT   CDS             486824..489067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0404"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99883"
FT                   /db_xref="GOA:D6ZY88"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY88"
FT                   /protein_id="ADG99883.1"
FT                   /translation="MSERIVRRIHMVFDIARMLAWQILPQRAAQRCIDELNATADAQNR
FT                   LVPSHYSWQQNRFHSVALRREHLATAGGGGRCTNHRSHIRPARKQKRVKPFGTLRKNVG
FT                   VIGQRQHDGRTAGPHYRLHISGQHPQTIAPVIHQRSHRNERSIRSHACLFSPKCRFRRS
FT                   AANRLIQWPIMPSLYRTNVTGRAALSRQPAATRSHNVPMMGGSVRPCQCSGHCTFSGES
FT                   MPPSAHRDERVRLTGRENHMNQACVRNDTIDAGNHHGRPQYRSFLRFLTSQERNVIWLL
FT                   LAVAFLPVDGTTLGLYAPFWSPISPALFAVYCLCNWRQLRIAANRYLPMFLLPVVCIIL
FT                   SIPGWLKFGIHLNAAFMSITGLLGVLATLGAIALAFDIKRIPWRTPLRILIASYWVSFG
FT                   VGVVQWLSIRLRAKPLTDYFSHLMYRQYISDNSVWGGGRPQFLFAEPSYIGMHLFGILL
FT                   PLMWLMRGRDRIYAKRLRDLIVTYAVGAVLMQAGTRIVIDSVVALLIALVARTDWHDGA
FT                   RRVRGMLQILGACALGLLGVLADSRLSAIAENGAEGDGSFFARIYQSLDPICGLLTHPW
FT                   TLLTGYGAGNIINAVWAGAAKAGRLLDGLGMNGGAATGFAAGVNADTVWTMCAYTSVIA
FT                   EYGLIGLAMLVGASMACMTRGRTVCRGGADGASSDGLAHGVCVTDVADVADVAGGNSGD
FT                   GVAGAGSGESGVWHKTVICWLVLVAYLYIQCENYAFAALPLLVFAASKVRRER"
     MSERIVRRIH MVFDIARMLA WQILPQRAAQ RCIDELNATA DAQNRLVPSH YSWQQNRFHS        60
     VALRREHLAT AGGGGRCTNH RSHIRPARKQ KRVKPFGTLR KNVGVIGQRQ HDGRTAGPHY       120
     RLHISGQHPQ TIAPVIHQRS HRNERSIRSH ACLFSPKCRF RRSAANRLIQ WPIMPSLYRT       180
     NVTGRAALSR QPAATRSHNV PMMGGSVRPC QCSGHCTFSG ESMPPSAHRD ERVRLTGREN       240
     HMNQACVRND TIDAGNHHGR PQYRSFLRFL TSQERNVIWL LLAVAFLPVD GTTLGLYAPF       300
     WSPISPALFA VYCLCNWRQL RIAANRYLPM FLLPVVCIIL SIPGWLKFGI HLNAAFMSIT       360
     GLLGVLATLG AIALAFDIKR IPWRTPLRIL IASYWVSFGV GVVQWLSIRL RAKPLTDYFS       420
     HLMYRQYISD NSVWGGGRPQ FLFAEPSYIG MHLFGILLPL MWLMRGRDRI YAKRLRDLIV       480
     TYAVGAVLMQ AGTRIVIDSV VALLIALVAR TDWHDGARRV RGMLQILGAC ALGLLGVLAD       540
     SRLSAIAENG AEGDGSFFAR IYQSLDPICG LLTHPWTLLT GYGAGNIINA VWAGAAKAGR       600
     LLDGLGMNGG AATGFAAGVN ADTVWTMCAY TSVIAEYGLI GLAMLVGASM ACMTRGRTVC       660
     RGGADGASSD GLAHGVCVTD VADVADVAGG NSGDGVAGAG SGESGVWHKT VICWLVLVAY       720
     LYIQCENYAF AALPLLVFAA SKVRRER                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page