(data stored in ACNUC30630 zone)

EMBL: CP002010.PE388

CP002010.PE388       Location/Qualifiers
FT   CDS             491873..492508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0408"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99887"
FT                   /db_xref="GOA:D6ZY91"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY91"
FT                   /protein_id="ADG99887.1"
FT                   /translation="MSNCLQLDHVDYAYGAAKILVLSDVSADFESGKMYAITGPSGAGK
FT                   STLLSLLAGLDAPSRGVVRFEGEDIAASGYAKHRREHVSLVFQDHNLIDYLTPEENLRL
FT                   VSTKADMKILEELGLSREESKRNIMHLSGGQRQRVAVGRALVAPGRAILADEPTGSLDP
FT                   EMTDEVIHLLQHAAHQLGKCVIVVTHSKRVADSADVVLRLRSKKLTRA"
     MSNCLQLDHV DYAYGAAKIL VLSDVSADFE SGKMYAITGP SGAGKSTLLS LLAGLDAPSR        60
     GVVRFEGEDI AASGYAKHRR EHVSLVFQDH NLIDYLTPEE NLRLVSTKAD MKILEELGLS       120
     REESKRNIMH LSGGQRQRVA VGRALVAPGR AILADEPTGS LDPEMTDEVI HLLQHAAHQL       180
     GKCVIVVTHS KRVADSADVV LRLRSKKLTR A                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page