(data stored in ACNUC30630 zone)

EMBL: CP002010.PE412

CP002010.PE412       Location/Qualifiers
FT   CDS             complement(526785..527219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0435"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99911"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZYB5"
FT                   /protein_id="ADG99911.1"
FT                   /translation="MASLLQGFEEVQLVKPVGKTVMTVTDSVVRFNKATAEVLNFPAQV
FT                   KILINDKTRQIAVTPTTAKADNAVKFSKGEGKQTTSVSIKNAVLVEAISKYFTLVEAPE
FT                   GEVSFASVNGTAYPEDKTVIFDVANATAGTMKRRGRKKAE"
     MASLLQGFEE VQLVKPVGKT VMTVTDSVVR FNKATAEVLN FPAQVKILIN DKTRQIAVTP        60
     TTAKADNAVK FSKGEGKQTT SVSIKNAVLV EAISKYFTLV EAPEGEVSFA SVNGTAYPED       120
     KTVIFDVANA TAGTMKRRGR KKAE                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page