(data stored in ACNUC30630 zone)

EMBL: CP002010.PE415

CP002010.PE415       Location/Qualifiers
FT   CDS             complement(531037..532020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0438"
FT                   /product="G5 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99914"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSQ9"
FT                   /protein_id="ADG99914.1"
FT                   /translation="MSKHAERTSIVKTLSRGQWAKIAAAVAAVGLIAAAGVISRDFYQA
FT                   STATHPITPTSFSATDGAASRSASRGALKSTTYVTVKVNGKSRVVLGEKDNMTTVKDVL
FT                   ETGDIVLDPEDSVSPSLDSKVSESTVISIDRANTTVETTDTDIAFNEVRKETSSLPNGQ
FT                   EKVETEGEKGVLETTSLVTRSGDKVVSSNVFTSWVKKAPVDKVILVGTATVSSPSAASL
FT                   GTTTPAGEIQSWAHDYLISNGYSEADFTAANFIISHESGWSPTATNPSSGAYGLPQALP
FT                   GSKMASAGADWQTNYQTQFKWFVNYCNGRYGSISGAYAYWQAHKSY"
     MSKHAERTSI VKTLSRGQWA KIAAAVAAVG LIAAAGVISR DFYQASTATH PITPTSFSAT        60
     DGAASRSASR GALKSTTYVT VKVNGKSRVV LGEKDNMTTV KDVLETGDIV LDPEDSVSPS       120
     LDSKVSESTV ISIDRANTTV ETTDTDIAFN EVRKETSSLP NGQEKVETEG EKGVLETTSL       180
     VTRSGDKVVS SNVFTSWVKK APVDKVILVG TATVSSPSAA SLGTTTPAGE IQSWAHDYLI       240
     SNGYSEADFT AANFIISHES GWSPTATNPS SGAYGLPQAL PGSKMASAGA DWQTNYQTQF       300
     KWFVNYCNGR YGSISGAYAY WQAHKSY                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page