(data stored in ACNUC30630 zone)

EMBL: CP002010.PE418

CP002010.PE418       Location/Qualifiers
FT   CDS             533524..534381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0441"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99917"
FT                   /db_xref="GOA:D6ZSR2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSR2"
FT                   /protein_id="ADG99917.1"
FT                   /translation="MAIELANHIYRDGEGVPVVLMNAYPVDHRMWDVCAKALADFADLN
FT                   DVPDFPIWAPDMAGSGASPVPSDADSGPRMANGAYSEALDRLAGAYVDLIKAAGYEQAI
FT                   WVGLSMGGYVAMDIQRLYPETVAGLALCDTMAASDGVGGENRLKMADAAEQTNSVEPVM
FT                   HFAQPADGDSTVKKTPEFIATMTGWINEQNPAGLAWRQRMTYGRPELGAVPETISAPSL
FT                   VVSGELDPSSNPSVMRPLAERIAGAEFIDIPDCGHFSAVEHPDTVARALLSLVRRVQNA
FT                   QKNA"
     MAIELANHIY RDGEGVPVVL MNAYPVDHRM WDVCAKALAD FADLNDVPDF PIWAPDMAGS        60
     GASPVPSDAD SGPRMANGAY SEALDRLAGA YVDLIKAAGY EQAIWVGLSM GGYVAMDIQR       120
     LYPETVAGLA LCDTMAASDG VGGENRLKMA DAAEQTNSVE PVMHFAQPAD GDSTVKKTPE       180
     FIATMTGWIN EQNPAGLAWR QRMTYGRPEL GAVPETISAP SLVVSGELDP SSNPSVMRPL       240
     AERIAGAEFI DIPDCGHFSA VEHPDTVARA LLSLVRRVQN AQKNA                       285
//

If you have problems or comments...

PBIL Back to PBIL home page