(data stored in ACNUC30630 zone)

EMBL: CP002010.PE421

CP002010.PE421       Location/Qualifiers
FT   CDS             536240..537571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0444"
FT                   /product="conserved hypothetical protein"
FT                   /note="narrowly conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99920"
FT                   /db_xref="InterPro:IPR019236"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSR5"
FT                   /protein_id="ADG99920.1"
FT                   /translation="MRSPREDFEAAGKRLPWDAAARNAALSATAPVSDVKASANGADNA
FT                   SNAEHSDDMPTVPIPARKAATTFDTPSKHERIEVKPPITRFIRRAITRVFGVWSHISTQ
FT                   VVRQWGWYPRVEPYVGYGTGDYSRLICRTVYAPKHAQSGELIRGIRGMLAVSAPRTHVQ
FT                   ASIDDTPLNTVQIGVSEVYDKVDRTRDLGSEYAISDSAGYLDLVAEHRLVPGIHRVSYS
FT                   VANRKPVSANLYTIPASAKVGIISDVDDTIMITQAPVPWKAAYNLLFLDPKKKASVPGM
FT                   SVLFTRIADLFPGAPFFYLSTSPWNVESSIRNFITDHGFPEGPLLLRDLDPRPKTFVPT
FT                   GPQHKLEFAEQLMADFPDMKFILVGDDGQKDPTTYATIARRYPGRVLAIVIRELSPRES
FT                   TGLASVTGLTSTQPTPVTDVPVFTGTTGSNILKTMLPYLKTVLR"
     MRSPREDFEA AGKRLPWDAA ARNAALSATA PVSDVKASAN GADNASNAEH SDDMPTVPIP        60
     ARKAATTFDT PSKHERIEVK PPITRFIRRA ITRVFGVWSH ISTQVVRQWG WYPRVEPYVG       120
     YGTGDYSRLI CRTVYAPKHA QSGELIRGIR GMLAVSAPRT HVQASIDDTP LNTVQIGVSE       180
     VYDKVDRTRD LGSEYAISDS AGYLDLVAEH RLVPGIHRVS YSVANRKPVS ANLYTIPASA       240
     KVGIISDVDD TIMITQAPVP WKAAYNLLFL DPKKKASVPG MSVLFTRIAD LFPGAPFFYL       300
     STSPWNVESS IRNFITDHGF PEGPLLLRDL DPRPKTFVPT GPQHKLEFAE QLMADFPDMK       360
     FILVGDDGQK DPTTYATIAR RYPGRVLAIV IRELSPREST GLASVTGLTS TQPTPVTDVP       420
     VFTGTTGSNI LKTMLPYLKT VLR                                               443
//

If you have problems or comments...

PBIL Back to PBIL home page